PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G10580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 568aa    MW: 61678.2 Da    PI: 8.0738
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G10580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.54.3e-1989122134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++Cgt +T++WR+gp+g++tLCnaCGl+yr+ +
  OPUNC10G10580.1  89 CRHCGTAETTQWRHGPEGHRTLCNACGLRYRSGK 122
                      *******************************976 PP

2GATA49.94.3e-16262295134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++CgttkTp WR gpd  ++LCnaCG +yr+  
  OPUNC10G10580.1 262 CAHCGTTKTPAWRLGPDSRRKLCNACGKKYRSGQ 295
                      *******************************976 PP

3GATA24.53.9e-08422439118
             GATA   1 CsnCgttkTplWRrgpdg 18 
                      C++Cg+t+TplWR gp+ 
  OPUNC10G10580.1 422 CRHCGSTETPLWRDGPEA 439
                      ***************975 PP

4GATA52.76e-17484518135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++CgttkTp WR gpd + +LCnaCG  yrk +l
  OPUNC10G10580.1 484 CTHCGTTKTPAWRLGPDSPGKLCNACGKQYRKGRL 518
                      ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.09E-1581144No hitNo description
Gene3DG3DSA:3.30.50.109.7E-1583122IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011413.29783119IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-1883137IPR000679Zinc finger, GATA-type
CDDcd002021.93E-1488137No hitNo description
PfamPF003202.6E-1689122IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-11255294No hitNo description
PROSITE profilePS5011411.978256292IPR000679Zinc finger, GATA-type
SMARTSM004017.4E-10256314IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.6E-12257312IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.02E-9261293No hitNo description
PfamPF003202.3E-14262295IPR000679Zinc finger, GATA-type
PROSITE profilePS501149.684416442IPR000679Zinc finger, GATA-type
SMARTSM004010.009416460IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-5421441IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011410.805478514IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-12478532IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-13479539No hitNo description
Gene3DG3DSA:3.30.50.107.5E-12482516IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.04E-12483532No hitNo description
PROSITE patternPS003440484509IPR000679Zinc finger, GATA-type
PfamPF003203.0E-15484518IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MVVVVDGLHD GDLFVGGGGR GLHALLDDAG LDDVAARGGE EEGEEVERPS NEDVFPAVEK  60
MATAAAPPVV AAVVQNRTTK AAAAEGLQCR HCGTAETTQW RHGPEGHRTL CNACGLRYRS  120
GKLVPEYRPL KSPTFSPELH SNKHRRVLQL RRRPKPKSAV PAHAVVARCG GDAGEAKEEE  180
EELACLSNKD AFPTMETMAP SPRVVETPPE HDHRHPNIPI TSPEPHSDRP RRVVQLPRRL  240
QEPSASTDLA IAVAATAVGR ECAHCGTTKT PAWRLGPDSR RKLCNACGKK YRSGQLNSTS  300
FSQNSPEQKK KKKKSSTCSR ERKRSAAAAT VVVVDGLRDD AAAIPDEHFD GDDLQALLDV  360
LDDVGLDDVA ARGGGDAGEA KEEEEELEWL SNKDAFPTVE TMSPAPQENR TKVPVPPAGW  420
QCRHCGSTET PLWRDGPEAE YVRKETSPAN IPATKHRRIV DLLRCSTAPN AAATATATAV  480
ELQCTHCGTT KTPAWRLGPD SPGKLCNACG KQYRKGRLVP EYRPLNSPTF SPELHSNAHA  540
HRRTFKLRRR RESSSSVAIA GEKSERKC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613898.10.0PREDICTED: siderophore biosynthesis regulatory protein URBS1-like
TrEMBLA0A0E0M8C90.0A0A0E0M8C9_ORYPU; Uncharacterized protein
STRINGORGLA10G0109200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157091414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.16e-27GATA transcription factor 1